PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009631939.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 282aa    MW: 32136.8 Da    PI: 5.9238
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009631939.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.21.2e-1790143356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k+++++ eq+++Le+ Fe+ +++  e++ +LA+ lgL+ rq+ +WFqNrRa+ k
  XP_009631939.1  90 KKRRLNLEQVKALERSFEMGNKLEPERKMQLARALGLKPRQIAIWFQNRRARCK 143
                     4557899*********************************************99 PP

2HD-ZIP_I/II127.74.9e-4189180192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     ekkrrl+ eqvk+LE+sFe+ +kLeperK++lar+Lgl+prq+a+WFqnrRAR ktkqlEkdye Lkr++d+lk +n++L++++++L++el 
  XP_009631939.1  89 EKKRRLNLEQVKALERSFEMGNKLEPERKMQLARALGLKPRQIAIWFQNRRARCKTKQLEKDYEILKRQCDKLKIDNDALKTQNKKLHSELL 180
                     69**************************************************************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.33E-1886147IPR009057Homeodomain-like
SMARTSM003898.2E-1888149IPR001356Homeobox domain
PROSITE profilePS5007116.1889145IPR001356Homeobox domain
PfamPF000467.9E-1590143IPR001356Homeobox domain
CDDcd000861.84E-1590146No hitNo description
Gene3DG3DSA:1.10.10.601.8E-1892152IPR009057Homeodomain-like
PRINTSPR000311.2E-5116125IPR000047Helix-turn-helix motif
PROSITE patternPS000270120143IPR017970Homeobox, conserved site
PRINTSPR000311.2E-5125141IPR000047Helix-turn-helix motif
PfamPF021835.0E-15145185IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MLFSSTMAFV PSTAQETSSV NFRNHEAAND DLPSSFPSHV FPSSCAPQQE FQGISPLLMR  60
RAMSFDHNQE SRVDDDMSDD DGSSHLLGEK KRRLNLEQVK ALERSFEMGN KLEPERKMQL  120
ARALGLKPRQ IAIWFQNRRA RCKTKQLEKD YEILKRQCDK LKIDNDALKT QNKKLHSELL  180
SLGNRESAGD TPPILFNLNK ENEGCNWNIN GSGDENNSTI DVNLGTTTTR TSSTNSPLNS  240
HDIFPTAYKV EQTVNEEGFC NMFTNVEDQT NFWPLPVQQH FY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137145RRARCKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009631939.10.0PREDICTED: homeobox-leucine zipper protein HAT7-like isoform X2
RefseqXP_016451121.10.0PREDICTED: homeobox-leucine zipper protein HAT7-like isoform X2
SwissprotQ004663e-60HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLK4B7731e-120K4B773_SOLLC; Uncharacterized protein
TrEMBLM1A9E41e-120M1A9E4_SOLTU; Uncharacterized protein
STRINGSolyc02g067410.1.11e-120(Solanum lycopersicum)
STRINGPGSC0003DMT4000177511e-120(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.19e-56homeobox 3